Product & ReviewsAntibodies
Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1)
Product Details
- Cat. No.
- CSB-EP010706HU(M16)
- Type
- Other Products
- Host
- Human

The supplier does not provide quotations for this antibody through SelectScience. You can search for similar antibodies in our Antibody Directory.
Description
Expression region:MHHHHHHRQIKIWFQNRRMKWKKGIGEVLHELADDLPELQSWIKAAQQLGGGGSGFLGPAPAPAPAPA+2-218aa;Full Length of Mature Protein.Tag:N-terminal 6xHis-tagged
Biological Information
- Host: Human
- Source: E.coli recombinant expression
- Gene: P00492
Handling
- Quantity: 20ug
- Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Applications
- SDS-PAGE (SDS-PAGE)
- ELISA (ELISA)
- Western Blotting (WB)
- Immunoassay (IA)


